PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_041470_muzn.t1
Common NameSOVF_041470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family HRT-like
Protein Properties Length: 400aa    MW: 44852.4 Da    PI: 10.3612
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_041470_muzn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like54.61.9e-17261290130
           HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                        +CGvi +dG+ C+++PvkgRKRC  HKG+R
  Sp_041470_muzn.t1 261 VCGVISSDGTSCSNPPVKGRKRCSNHKGRR 290
                        7****************************9 PP

2HRT-like62.94.6e-20319349131
           HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                        +CGvil dGs+C+r+P +gRKRCeeHKGmRi
  Sp_041470_muzn.t1 319 VCGVILLDGSPCTRSPFPGRKRCEEHKGMRI 349
                        7*****************************7 PP

3HRT-like55.68.9e-18370399231
           HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                        CGv+l+dG +C++qPvkgRKRCe+HKGmR+
  Sp_041470_muzn.t1 370 CGVNLGDGKCCEKQPVKGRKRCEQHKGMRV 399
                        *****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd007190.00591162No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGGELPRLHT PTTTTTTATT AKLKRENHLK TKHDTAFSKW KILIGASDWV DYEAKKEGAE  60
RYRVSNLPKV CSPGLYEIGV AVCLSGSGRD LETERIVVVY LGQADNVRSR LQEYGRTGSH  120
LVHGFGLFKD IFSTGFPIVY RWAAMKSKSD AERTESELLE RFDYAWNKIG NNARRPNDVL  180
SKIEKISSRN YKIPKIMKML QSLGEQKVGI QIQAEKLSIG NKPKPSYEEN LSLFDRVFKF  240
SRSQPRLVST TNSEDLNQTQ VCGVISSDGT SCSNPPVKGR KRCSNHKGRR LNSVVFINSK  300
NSSRKHNVVV HDKVEVSSVC GVILLDGSPC TRSPFPGRKR CEEHKGMRII NQIMSKSSIL  360
KSVTDSVHHC GVNLGDGKCC EKQPVKGRKR CEQHKGMRVR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687447.10.0PREDICTED: uncharacterized protein LOC104901555
TrEMBLA0A0K9RRX00.0A0A0K9RRX0_SPIOL; Uncharacterized protein
STRINGVIT_11s0016g02440.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.18e-88effector of transcription2